PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00520g00614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family CPP
Protein Properties Length: 787aa    MW: 85835.5 Da    PI: 6.353
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00520g00614.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.93.1e-16499537240
                       TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                               ++k+CnCkkskClk+YCeCfaag++C e C C+dC+Nk 
  Peaxi162Scf00520g00614.1 499 SCKRCNCKKSKCLKLYCECFAAGVYCVEPCACQDCFNKP 537
                               689**********************************96 PP

2TCR51.12.7e-16584622139
                       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                               ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Peaxi162Scf00520g00614.1 584 RHKRGCNCKKSGCLKKYCECYQGGVGCSINCRCEGCKNA 622
                               589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575120No hitNo description
SMARTSM011141.6E-17498539IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.877499624IPR005172CRC domain
PfamPF036389.7E-12501536IPR005172CRC domain
SMARTSM011147.5E-18584625IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.7E-12586622IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
MLKCTVGGLY HILLVLLYSC FFFPLRNLMV FFSSMQESPV FNFLNNLSPI KLDKSMHFHQ  60
TLNSLSFASI PSVFTSPHVS SIRESRFLRR HLLSDPSKPE FASDNGVKVD TDEGTLDAVN  120
NSNEPKESFG SGISVVEAPA SPSHECSKLT VELARNLNYE CSSPSTLPTG GIGSRGLSEF  180
AGSSVTYVPL VQEMSGKGLL RCDMNMDRIK ETDPNKEASG CDWENLISDA TDLLIFDSPG  240
DPEAFTKATG PNFRPLEFVS NEMQNMQNIS QVSTSEYGGD GSETEKPSTQ PGEESQLMDY  300
AETQNMKPDA SLTNAGMGVG QSEKNDNEMV STLYRGMRRR CLVFEMGGTR RKHMNEVSGS  360
SAVQEADGNL ASSENQLVTS KTVNESSRCI LPGIGLHLNA LAASSKDGKV VKHEANASGK  420
QLLITSCSAV NFHPLVTGQE SLSKSLPETS REGEIVPFEN SIPLMEDVCQ APGYVNNEEL  480
NQSSPKKKRR RLEPGEGESC KRCNCKKSKC LKLYCECFAA GVYCVEPCAC QDCFNKPIHE  540
DTVLATRKQI ESRNPLAFAP KVIRTTDSLS ETVDDSSKTP ASARHKRGCN CKKSGCLKKY  600
CECYQGGVGC SINCRCEGCK NAFGRKDGTD GDAEEEGTDA YEKSIIDRTS HKNLVQSDVE  660
QNPDSATPAT PLSFGRPPMQ IPFSLKNKPP RSSFLSIGSS SGVYAGQGIG RPNFFQPHPK  720
FESIQEDEMP EILQETSSPI SGIKTASPNR KRVSPPHGDF GNSPSRRSSR KLILQSIPSF  780
PSLTPNP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1484491PKKKRRRL
2485490KKKRRR
3487491KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770245.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X2
TrEMBLM1D5M10.0M1D5M1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000820980.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-135TESMIN/TSO1-like CXC 2